SCOPe 2.04: Domain d2fh7a2: 2fh7 A:1697-1942

Lineage for d2fh7a2 (2fh7 A:1697-1942)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (21 PDB entries)

8. Domain d2fh7a2: 2fh7 A:1697-1942 [230733]
   automated match to d1lara2

Details for d2fh7a2

PDB Entry: 2fh7, 2 Å

PDB Description: crystal structure of the phosphatase domains of human ptp sigma

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase S

SCOPe Domain Sequences for d2fh7a2:

Sequence; same for both SEQRES and ATOM records:

>d2fh7a2 c.45.1.2 (A:1697-1942) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fisanlpcnkfknrlvnimpyestrvclqpirgvegsdyinasfidgyrqqkayiatqgp
laettedfwrmlwennstivvmltklremgrekchqywpaersaryqyfvvdpmaeynmp
qyilrefkvtdardgqsrtvrqfqftdwpeqgvpksgegfidfigqvhktkeqfgqdgpi
svhcsagvgrtgvfitlsivlermryegvvdifqtvkmlrtqrpamvqtedeyqfcyqaa
leylgs

Timeline for d2fh7a2:

• d2fh7a2 first appeared in SCOPe 2.03
  
• d2fh7a2 appears in SCOPe 2.05
  
• d2fh7a2 appears in the current release, SCOPe 2.08