Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) |
Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
Protein automated matches [190706] (5 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [230722] (1 PDB entry) |
Domain d2ekna_: 2ekn A: [230724] automated match to d4fdfb_ complexed with flc |
PDB Entry: 2ekn (more details), 2.05 Å
SCOPe Domain Sequences for d2ekna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekna_ d.58.21.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} gvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpe liplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkav ekdekgqypytrienvhvvekvkth
Timeline for d2ekna_: