Lineage for d2ekna_ (2ekn A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521368Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2521374Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2521375Protein automated matches [190706] (6 species)
    not a true protein
  7. 2521387Species Pyrococcus horikoshii OT3 [TaxId:70601] [230722] (1 PDB entry)
  8. 2521388Domain d2ekna_: 2ekn A: [230724]
    automated match to d4fdfb_
    complexed with flc

Details for d2ekna_

PDB Entry: 2ekn (more details), 2.05 Å

PDB Description: Structure of PH1811 protein from Pyrococcus horikoshii
PDB Compounds: (A:) Probable molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2ekna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekna_ d.58.21.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
gvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpe
liplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkav
ekdekgqypytrienvhvvekvkth

SCOPe Domain Coordinates for d2ekna_:

Click to download the PDB-style file with coordinates for d2ekna_.
(The format of our PDB-style files is described here.)

Timeline for d2ekna_: