Lineage for d2eknc_ (2ekn C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417485Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 1417491Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 1417492Protein automated matches [190706] (5 species)
    not a true protein
  7. 1417498Species Pyrococcus horikoshii [TaxId:70601] [230722] (1 PDB entry)
  8. 1417501Domain d2eknc_: 2ekn C: [230723]
    automated match to d4fdfb_
    complexed with flc

Details for d2eknc_

PDB Entry: 2ekn (more details), 2.05 Å

PDB Description: Structure of PH1811 protein from Pyrococcus horikoshii
PDB Compounds: (C:) Probable molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2eknc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eknc_ d.58.21.0 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
vkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrtpel
iplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkave
kdekgqypytrienvhvvekvkthn

SCOPe Domain Coordinates for d2eknc_:

Click to download the PDB-style file with coordinates for d2eknc_.
(The format of our PDB-style files is described here.)

Timeline for d2eknc_: