SCOPe 2.03: Domain d2ei0a1: 2ei0 A:5-137

Lineage for d2ei0a1 (2ei0 A:5-137)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (14 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:69011] [230718] (1 PDB entry)

8. Domain d2ei0a1: 2ei0 A:5-137 [230719]
   automated match to d2wl3b1
   complexed with bp7, fe2, gol, mg

Details for d2ei0a1

PDB Entry: 2ei0, 1.6 Å

PDB Description: Anaerobic Crystal Structure Analysis of 1,2-dihydroxynaphthalene dioxygenase from Pseudomonas sp. strain C18 complexed with 3,4-dihydroxybiphenyl

PDB Compounds: (A:) 1,2-dihydroxynaphthalene dioxygenase

SCOPe Domain Sequences for d2ei0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ei0a1 d.32.1.0 (A:5-137) automated matches {Pseudomonas sp. [TaxId: 69011]}
aavielgymgisvkdpdawksfatdmlglqvldegekdrfylrmdywhhrivvhhngqdd
leylgwrvagkpefealgqklidagykiricdkveaqermvlglmktedpggnpteifwg
pridmsnpfhpgr

Timeline for d2ei0a1:

• d2ei0a1 is new in SCOPe 2.03-stable
  
• d2ei0a1 appears in SCOPe 2.04
  
• d2ei0a1 appears in the current release, SCOPe 2.08