Lineage for d2efqa2 (2efq A:61-150)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193227Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2193599Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2193600Protein automated matches [190081] (27 species)
    not a true protein
  7. 2193904Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries)
  8. 2193911Domain d2efqa2: 2efq A:61-150 [230711]
    Other proteins in same PDB: d2efqa1
    automated match to d2cyya2
    complexed with gln, mg

Details for d2efqa2

PDB Entry: 2efq (more details), 2.3 Å

PDB Description: crystal structure of thr134 to ala of st1022-glutamine complex from sulfolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2efqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efqa2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertsaqvvvkiikespnivif

SCOPe Domain Coordinates for d2efqa2:

Click to download the PDB-style file with coordinates for d2efqa2.
(The format of our PDB-style files is described here.)

Timeline for d2efqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efqa1