Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
Protein automated matches [230679] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries) |
Domain d2e0ab1: 2e0a B:20-187 [230681] Other proteins in same PDB: d2e0aa2, d2e0ab2 automated match to d1jm6a1 complexed with anp, mg |
PDB Entry: 2e0a (more details), 1.86 Å
SCOPe Domain Sequences for d2e0ab1:
Sequence, based on SEQRES records: (download)
>d2e0ab1 a.29.5.0 (B:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn
>d2e0ab1 a.29.5.0 (B:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgscertsfaflrqelpvrlanilkeidilptqlvnt ssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiieyk dactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn
Timeline for d2e0ab1: