SCOPe 2.05: Domain d2doub_: 2dou B:

Lineage for d2doub_ (2dou B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187350] (2 PDB entries)

8. Domain d2doub_: 2dou B: [230653]
   automated match to d2x5da_
   complexed with epe, so4

Details for d2doub_

PDB Entry: 2dou, 2.3 Å

PDB Description: probable N-succinyldiaminopimelate aminotransferase (TTHA0342) from Thermus thermophilus HB8

PDB Compounds: (B:) probable N-succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d2doub_:

Sequence; same for both SEQRES and ATOM records:

>d2doub_ c.67.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
svflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyclksctlp
fleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpevaypsyfga
arvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyfeealgla
rkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlgfalgsee
alarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaealkgvlsll
ppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrpleellea
akrireal

Timeline for d2doub_:

• d2doub_ first appeared in SCOPe 2.03
  
• d2doub_ appears in SCOPe 2.04
  
• d2doub_ appears in SCOPe 2.06
  
• d2doub_ appears in the current release, SCOPe 2.08