Lineage for d2d5va2 (2d5v A:100-155)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1478383Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1478384Protein automated matches [190674] (14 species)
    not a true protein
  7. 1478458Species Norway rat (Rattus norvegicus) [TaxId:10116] [230637] (1 PDB entry)
  8. 1478459Domain d2d5va2: 2d5v A:100-155 [230638]
    Other proteins in same PDB: d2d5va1, d2d5vb1
    automated match to d1s7ea1
    protein/DNA complex; complexed with act, gol

Details for d2d5va2

PDB Entry: 2d5v (more details), 2 Å

PDB Description: Crystal structure of HNF-6alpha DNA-binding domain in complex with the TTR promoter
PDB Compounds: (A:) Hepatocyte nuclear factor 6

SCOPe Domain Sequences for d2d5va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5va2 a.4.1.0 (A:100-155) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnarrrsldk

SCOPe Domain Coordinates for d2d5va2:

Click to download the PDB-style file with coordinates for d2d5va2.
(The format of our PDB-style files is described here.)

Timeline for d2d5va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d5va1