Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Escherichia coli [TaxId:562] [226067] (4 PDB entries) |
Domain d2d3wa_: 2d3w A: [230632] automated match to d2d2ea_ |
PDB Entry: 2d3w (more details), 2.5 Å
SCOPe Domain Sequences for d2d3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3wa_ c.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg ygwl
Timeline for d2d3wa_: