SCOPe 2.05: Domain d2d3va2: 2d3v A:95-195

Lineage for d2d3va2 (2d3v A:95-195)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2d3va2: 2d3v A:95-195 [230630]
   automated match to d2dlia2

Details for d2d3va2

PDB Entry: 2d3v, 1.85 Å

PDB Description: crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11)

PDB Compounds: (A:) leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1

SCOPe Domain Sequences for d2d3va2:

Sequence, based on SEQRES records:

>d2d3va2 b.1.1.0 (A:95-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgfynkptlsalpspvvtsgenvtlqcgsrlrfdrfilteegdhklswtldsqltpsgqf
qalfpvgpvtpshrwmlrcygsrrhilqvwsepsdlleipv

Sequence, based on observed residues (ATOM records):

>d2d3va2 b.1.1.0 (A:95-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgfynkptlsavtlqcgsrlrfdrfilteeklswtldsqltpsgqfqalfpvgpvtpshr
wmlrcygsrrhilqvwsepsdlleipv

Timeline for d2d3va2:

• d2d3va2 first appeared in SCOPe 2.03
  
• d2d3va2 appears in SCOPe 2.04
  
• d2d3va2 appears in SCOPe 2.06
  
• d2d3va2 appears in the current release, SCOPe 2.08