Lineage for d2d3va1 (2d3v A:3-94)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295914Domain d2d3va1: 2d3v A:3-94 [230629]
    automated match to d2dl2a1

Details for d2d3va1

PDB Entry: 2d3v (more details), 1.85 Å

PDB Description: crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11)
PDB Compounds: (A:) leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1

SCOPe Domain Sequences for d2d3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3va1 b.1.1.0 (A:3-94) automated matches {Homo sapiens [TaxId: 9606]}
lskatlwaepgsvisrgnsvtircqgtleaqeyrlvkegspepwdtqnplepknkarfsi
psmtehhagryrcyyyspagwsepsdplelvv

SCOPe Domain Coordinates for d2d3va1:

Click to download the PDB-style file with coordinates for d2d3va1.
(The format of our PDB-style files is described here.)

Timeline for d2d3va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d3va2