SCOPe 2.07: Domain d2be7d2: 2be7 D:100-151

Lineage for d2be7d2 (2be7 D:100-151)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Moritella profunda [TaxId:111291] [230528] (1 PDB entry)

8. Domain d2be7d2: 2be7 D:100-151 [230529]
   Other proteins in same PDB: d2be7a1, d2be7a2, d2be7b1, d2be7b2, d2be7c1, d2be7c2, d2be7d1, d2be7e1, d2be7f1
   automated match to d2atcb2
   complexed with so4, zn

Details for d2be7d2

PDB Entry: 2be7, 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be7d2:

Sequence; same for both SEQRES and ATOM records:

>d2be7d2 g.41.7.1 (D:100-151) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Moritella profunda [TaxId: 111291]}
nevenvfpcpnsncithgepvtssfsikktkgniglkckycektfskdivte

Timeline for d2be7d2:

• d2be7d2 first appeared in SCOPe 2.03
  
• d2be7d2 appears in SCOPe 2.06
  
• d2be7d2 appears in the current release, SCOPe 2.08