Lineage for d2be7d1 (2be7 D:12-99)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193033Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2193034Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2193035Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2193168Species Moritella profunda [TaxId:111291] [230525] (1 PDB entry)
  8. 2193169Domain d2be7d1: 2be7 D:12-99 [230526]
    Other proteins in same PDB: d2be7a1, d2be7a2, d2be7b1, d2be7b2, d2be7c1, d2be7c2, d2be7d2, d2be7e2, d2be7f2
    automated match to d2atcb1
    complexed with so4, zn

Details for d2be7d1

PDB Entry: 2be7 (more details), 2.85 Å

PDB Description: crystal structure of the unliganded (t-state) aspartate transcarbamoylase of the psychrophilic bacterium moritella profunda
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2be7d1:

Sequence, based on SEQRES records: (download)

>d2be7d1 d.58.2.1 (D:12-99) Aspartate carbamoyltransferase {Moritella profunda [TaxId: 111291]}
cngyvidhipsgqgvkilklfsltdtkqrvtvgfnlptkdgnakdlikventeitksqan
qlallapnatiniienfkvtdkhsltlp

Sequence, based on observed residues (ATOM records): (download)

>d2be7d1 d.58.2.1 (D:12-99) Aspartate carbamoyltransferase {Moritella profunda [TaxId: 111291]}
cngyvidhipsgqgvkilklfsltdtkqrvtvgfnlkdlikventeitksqanqlallap
natiniienfkvtdkhsltlp

SCOPe Domain Coordinates for d2be7d1:

Click to download the PDB-style file with coordinates for d2be7d1.
(The format of our PDB-style files is described here.)

Timeline for d2be7d1: