SCOPe 2.06: Domain d2ajqf1: 2ajq F:1-210

Lineage for d2ajqf1 (2ajq F:1-210)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
   Uniprot P00581

8. Domain d2ajqf1: 2ajq F:1-210 [230512]
   Other proteins in same PDB: d2ajqa2, d2ajqb_, d2ajqf2, d2ajqi_
   automated match to d1x9ma1
   protein/DNA complex

Details for d2ajqf1

PDB Entry: 2ajq, 2.6 Å

PDB Description: structure of replicative dna polymerase provides insigts into the mechanisms for processivity, frameshifting and editing

PDB Compounds: (F:) T7 DNA polymerase

SCOPe Domain Sequences for d2ajqf1:

Sequence; same for both SEQRES and ATOM records:

>d2ajqf1 c.55.3.5 (F:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsaiaanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgkrf
gshaleawgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtka
llekllsdkhyfppeidftdvgyttfwses

Timeline for d2ajqf1:

• d2ajqf1 first appeared in SCOPe 2.03
  
• d2ajqf1 appears in SCOPe 2.05
  
• d2ajqf1 appears in SCOPe 2.07
  
• d2ajqf1 appears in the current release, SCOPe 2.08