Lineage for d1nica1 (1nic A:8-166)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044087Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2044088Species Achromobacter cycloclastes [TaxId:223] [49552] (25 PDB entries)
  8. 2044127Domain d1nica1: 1nic A:8-166 [23050]
    complexed with cu, so4

Details for d1nica1

PDB Entry: 1nic (more details), 1.9 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1nica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nica1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d1nica1:

Click to download the PDB-style file with coordinates for d1nica1.
(The format of our PDB-style files is described here.)

Timeline for d1nica1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nica2