Lineage for d1zxnb2 (1zxn B:266-424)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637334Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1637335Protein automated matches [190826] (16 species)
    not a true protein
  7. 1637390Species Human (Homo sapiens) [TaxId:9606] [189350] (4 PDB entries)
  8. 1637402Domain d1zxnb2: 1zxn B:266-424 [230474]
    Other proteins in same PDB: d1zxna1, d1zxnb1, d1zxnc1, d1zxnd1
    automated match to d1zxmb2
    complexed with adp, gol, mg, so4

Details for d1zxnb2

PDB Entry: 1zxn (more details), 2.51 Å

PDB Description: Human DNA topoisomerase IIa ATPase/ADP
PDB Compounds: (B:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxnb2:

Sequence, based on SEQRES records: (download)

>d1zxnb2 d.14.1.0 (B:266-424) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp
ksfgstcqlsekfikaaigcgivesilnwvkfkaqvqln

Sequence, based on observed residues (ATOM records): (download)

>d1zxnb2 d.14.1.0 (B:266-424) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivt
klvdvvkkkkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaa
igcgivesilnwvkfkaqvqln

SCOPe Domain Coordinates for d1zxnb2:

Click to download the PDB-style file with coordinates for d1zxnb2.
(The format of our PDB-style files is described here.)

Timeline for d1zxnb2: