Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (4 PDB entries) |
Domain d1zxnb2: 1zxn B:266-424 [230474] Other proteins in same PDB: d1zxna1, d1zxnb1, d1zxnc1, d1zxnd1 automated match to d1zxmb2 complexed with adp, gol, mg, so4 |
PDB Entry: 1zxn (more details), 2.51 Å
SCOPe Domain Sequences for d1zxnb2:
Sequence, based on SEQRES records: (download)
>d1zxnb2 d.14.1.0 (B:266-424) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp ksfgstcqlsekfikaaigcgivesilnwvkfkaqvqln
>d1zxnb2 d.14.1.0 (B:266-424) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivt klvdvvkkkkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaa igcgivesilnwvkfkaqvqln
Timeline for d1zxnb2: