![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
![]() | Domain d1zlwk2: 1zlw K:108-212 [230458] Other proteins in same PDB: d1zlwh1, d1zlwh2, d1zlwk1, d1zlwl1, d1zlwm1, d1zlwm2 automated match to d1n0xl2 complexed with man |
PDB Entry: 1zlw (more details), 2.85 Å
SCOPe Domain Sequences for d1zlwk2:
Sequence, based on SEQRES records: (download)
>d1zlwk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
>d1zlwk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskyekhkvyacevthqglsspvtksfnrg
Timeline for d1zlwk2: