![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (23 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries) |
![]() | Domain d1zlwk1: 1zlw K:2-107 [230455] Other proteins in same PDB: d1zlwh1, d1zlwh2, d1zlwk2, d1zlwl2, d1zlwm1, d1zlwm2 automated match to d1n0xl1 complexed with man |
PDB Entry: 1zlw (more details), 2.85 Å
SCOPe Domain Sequences for d1zlwk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlwk1 b.1.1.0 (K:2-107) automated matches {Homo sapiens [TaxId: 9606]} vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik
Timeline for d1zlwk1: