SCOPe 2.05: Domain d1zluk1: 1zlu K:2-107

Lineage for d1zluk1 (1zlu K:2-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d1zluk1: 1zlu K:2-107 [230451]
   Other proteins in same PDB: d1zluh1, d1zluh2, d1zluk2, d1zlul2, d1zlum1, d1zlum2
   automated match to d1n0xl1

Details for d1zluk1

PDB Entry: 1zlu, 2.75 Å

PDB Description: fab 2g12 + man5

PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zluk1:

Sequence; same for both SEQRES and ATOM records:

>d1zluk1 b.1.1.0 (K:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik

Timeline for d1zluk1:

• d1zluk1 first appeared in SCOPe 2.03
  
• d1zluk1 appears in SCOPe 2.04
  
• d1zluk1 appears in SCOPe 2.06
  
• d1zluk1 last appears in SCOPe 2.07