![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
![]() | Domain d1zlvk2: 1zlv K:108-212 [230450] Other proteins in same PDB: d1zlvh1, d1zlvh2, d1zlvk1, d1zlvl1, d1zlvm1, d1zlvm2 automated match to d1n0xl2 complexed with man |
PDB Entry: 1zlv (more details), 2.33 Å
SCOPe Domain Sequences for d1zlvk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlvk2 b.1.1.2 (K:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1zlvk2: