Lineage for d1zlvk1 (1zlv K:2-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295933Domain d1zlvk1: 1zlv K:2-107 [230449]
    Other proteins in same PDB: d1zlvh1, d1zlvh2, d1zlvk2, d1zlvl2, d1zlvm1, d1zlvm2
    automated match to d1n0xl1
    complexed with man

Details for d1zlvk1

PDB Entry: 1zlv (more details), 2.33 Å

PDB Description: fab 2g12 + man7
PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlvk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlvk1 b.1.1.0 (K:2-107) automated matches {Homo sapiens [TaxId: 9606]}
vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik

SCOPe Domain Coordinates for d1zlvk1:

Click to download the PDB-style file with coordinates for d1zlvk1.
(The format of our PDB-style files is described here.)

Timeline for d1zlvk1: