SCOPe 2.07: Domain d1zlvl2: 1zlv L:108-212

Lineage for d1zlvl2 (1zlv L:108-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d1zlvl2: 1zlv L:108-212 [230448]
   Other proteins in same PDB: d1zlvh1, d1zlvh2, d1zlvk1, d1zlvl1, d1zlvm1, d1zlvm2
   automated match to d1n0xl2
   complexed with man

Details for d1zlvl2

PDB Entry: 1zlv, 2.33 Å

PDB Description: fab 2g12 + man7

PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlvl2:

Sequence; same for both SEQRES and ATOM records:

>d1zlvl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1zlvl2:

• d1zlvl2 first appeared in SCOPe 2.03
  
• d1zlvl2 appears in SCOPe 2.06
  
• d1zlvl2 does not appear in SCOPe 2.08