SCOPe 2.05: Domain d1zlsl2: 1zls L:108-210

Lineage for d1zlsl2 (1zls L:108-210)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d1zlsl2: 1zls L:108-210 [230446]
   Other proteins in same PDB: d1zlsh1, d1zlsh2, d1zlsl1
   automated match to d1n0xl2

Details for d1zlsl2

PDB Entry: 1zls, 2 Å

PDB Description: fab 2g12 + man4

PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d1zlsl2:

Sequence; same for both SEQRES and ATOM records:

>d1zlsl2 b.1.1.2 (L:108-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

Timeline for d1zlsl2:

• d1zlsl2 first appeared in SCOPe 2.03
  
• d1zlsl2 appears in SCOPe 2.04
  
• d1zlsl2 appears in SCOPe 2.06
  
• d1zlsl2 last appears in SCOPe 2.07