Lineage for d1yc8b_ (1yc8 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512733Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)
  8. 1512768Domain d1yc8b_: 1yc8 B: [230416]
    automated match to d1yzzb_
    mutant

Details for d1yc8b_

PDB Entry: 1yc8 (more details), 2.7 Å

PDB Description: caban33- y37v/e44g/r45l triple mutant
PDB Compounds: (B:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yc8b_:

Sequence, based on SEQRES records: (download)

>d1yc8b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyqd
svkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d1yc8b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgglewvssisspgtiyyqds
vkgrftisrdnakntvylqmnslqredtgmyycqiqcrsireywgqgtqvtvs

SCOPe Domain Coordinates for d1yc8b_:

Click to download the PDB-style file with coordinates for d1yc8b_.
(The format of our PDB-style files is described here.)

Timeline for d1yc8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yc8a_