Lineage for d1yb4a1 (1yb4 A:1-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848418Species Salmonella typhimurium [TaxId:99287] [230409] (3 PDB entries)
  8. 2848419Domain d1yb4a1: 1yb4 A:1-160 [230410]
    Other proteins in same PDB: d1yb4a2, d1yb4b2
    automated match to d1vpda2

Details for d1yb4a1

PDB Entry: 1yb4 (more details), 2.4 Å

PDB Description: Crystal Structure of the Tartronic Semialdehyde Reductase from Salmonella typhimurium LT2
PDB Compounds: (A:) tartronic semialdehyde reductase

SCOPe Domain Sequences for d1yb4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb4a1 c.2.1.0 (A:1-160) automated matches {Salmonella typhimurium [TaxId: 99287]}
mklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefadiif
imvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadyldapvs
ggeigaregtlsimvggeqkvfdrvkplfdilgknitlvg

SCOPe Domain Coordinates for d1yb4a1:

Click to download the PDB-style file with coordinates for d1yb4a1.
(The format of our PDB-style files is described here.)

Timeline for d1yb4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yb4a2