SCOPe 2.01: Domain d1ehkb1: 1ehk B:41-168

Lineage for d1ehkb1 (1ehk B:41-168)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries)

8. Domain d1ehkb1: 1ehk B:41-168 [23041]
   Other proteins in same PDB: d1ehka_, d1ehkb2, d1ehkc_
   complexed with bng, cu, cua, has, hem

Details for d1ehkb1

PDB Entry: 1ehk, 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

PDB Compounds: (B:) ba3-type cytochrome-c oxidase

SCOPe Domain Sequences for d1ehkb1:

Sequence; same for both SEQRES and ATOM records:

>d1ehkb1 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

Timeline for d1ehkb1:

• d1ehkb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ehkb1 appears in SCOP 1.75
  
• d1ehkb1 appears in SCOPe 2.02
  
• d1ehkb1 appears in the current release, SCOPe 2.08