Lineage for d1ehkb1 (1ehk B:41-168)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369398Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 369399Protein Cytochrome c oxidase [49544] (4 species)
  7. 369423Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)
  8. 369426Domain d1ehkb1: 1ehk B:41-168 [23041]
    Other proteins in same PDB: d1ehka_, d1ehkb2, d1ehkc_
    complexed with 1cu, bng, cua, has, hem

Details for d1ehkb1

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehkb1 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

SCOP Domain Coordinates for d1ehkb1:

Click to download the PDB-style file with coordinates for d1ehkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ehkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehkb2