SCOPe 2.07: Domain d1y4ya_: 1y4y A:

Lineage for d1y4ya_ (1y4y A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [230401] (3 PDB entries)

8. Domain d1y4ya_: 1y4y A: [230402]
   automated match to d1qfra_
   complexed with so4

Details for d1y4ya_

PDB Entry: 1y4y, 2 Å

PDB Description: X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr)

PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1y4ya_:

Sequence; same for both SEQRES and ATOM records:

>d1y4ya_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Geobacillus stearothermophilus [TaxId: 1422]}
aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
kitaegadaaeamaaltdtlakeglae

Timeline for d1y4ya_:

• d1y4ya_ first appeared in SCOPe 2.03
  
• d1y4ya_ appears in SCOPe 2.06
  
• d1y4ya_ appears in the current release, SCOPe 2.08