SCOP 1.63: Domain d2cuab_: 2cua B:

Lineage for d2cuab_ (2cua B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)

8. Domain d2cuab_: 2cua B: [23040]
   complexed with cua, zn

Details for d2cuab_

PDB Entry: 2cua, 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

SCOP Domain Sequences for d2cuab_:

Sequence, based on SEQRES records:

>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
glghqnmfgtivvke

Sequence, based on observed residues (ATOM records):

>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d2cuab_:

• d2cuab_ first appeared (with stable ids) in SCOP 1.55
  
• d2cuab_ appears in SCOP 1.61
  
• d2cuab_ appears in SCOP 1.65
  
• d2cuab_ appears in the current release, SCOPe 2.08