Lineage for d2cuab_ (2cua B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106887Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 106888Protein Cytochrome c oxidase [49544] (3 species)
  7. 106903Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)
  8. 106905Domain d2cuab_: 2cua B: [23040]

Details for d2cuab_

PDB Entry: 2cua (more details), 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

SCOP Domain Sequences for d2cuab_:

Sequence, based on SEQRES records: (download)

>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
glghqnmfgtivvke

Sequence, based on observed residues (ATOM records): (download)

>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOP Domain Coordinates for d2cuab_:

Click to download the PDB-style file with coordinates for d2cuab_.
(The format of our PDB-style files is described here.)

Timeline for d2cuab_: