Lineage for d2cuab_ (2cua B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) Protein Cytochrome c oxidase [49544] (3 species) Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries) 
Domain d2cuab_: 2cua B: [23040]
Details for d2cuab_
PDB Entry: 2cua (more details), 1.6 Å
PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus
SCOP Domain Sequences for d2cuab_:
Sequence, based on SEQRES records: (download)
>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpn
pievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqyc
glghqnmfgtivvke
Sequence, based on observed residues (ATOM records): (download)
>d2cuab_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aytlathtagagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke
SCOP Domain Coordinates for d2cuab_:
Click to download the PDB-style file with coordinates for d2cuab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cuab_:
- d2cuab_ appears in SCOP 1.57
- d2cuab_ appears in the current release, SCOPe 2.08
View in 3D
