SCOPe 2.08: Domain d1x55a2: 1x55 A:105-434

Lineage for d1x55a2 (1x55 A:105-434)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [230395] (3 PDB entries)

8. Domain d1x55a2: 1x55 A:105-434 [230398]
   Other proteins in same PDB: d1x55a1
   automated match to d1b8aa2
   protein/RNA complex; complexed with mg, nss, po4

Details for d1x55a2

PDB Entry: 1x55, 1.8 Å

PDB Description: Crystal structure of asparaginyl-tRNA synthetase from Pyrococcus horikoshii complexed with asparaginyl-adenylate analogue

PDB Compounds: (A:) Asparaginyl-tRNA synthetase

SCOPe Domain Sequences for d1x55a2:

Sequence; same for both SEQRES and ATOM records:

>d1x55a2 d.104.1.0 (A:105-434) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
pipenpeqaspellldyrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvt
gaveggatlfklkyfdkyaylsqsaqlyleaaifglekvwsltpsfraeksrtrrhltef
whleleaawmdlwdimkveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisy
deaidilqskgvnvewgddlgadeervlteefdrpffvygypkhikafymkedpndprkv
lasdmlapegygeiiggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfgl
gverlvawvlkldhirwaalfprtparlyp

Timeline for d1x55a2:

• d1x55a2 first appeared in SCOPe 2.03
  
• d1x55a2 appears in SCOPe 2.07