Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [187575] (4 PDB entries) |
Domain d1x54a1: 1x54 A:1-104 [230394] Other proteins in same PDB: d1x54a2 automated match to d1b8aa1 protein/RNA complex; complexed with 4ad, mg, mpd |
PDB Entry: 1x54 (more details), 1.45 Å
SCOPe Domain Sequences for d1x54a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x54a1 b.40.4.0 (A:1-104) automated matches {Pyrococcus horikoshii [TaxId: 53953]} miekvycqevkpeldgkkvrlagwvytnmrvgkkiflwirdstgivqavvaknvvgeetf ekakklgressvivegivkaderapggaevhvekleviqavsef
Timeline for d1x54a1: