Lineage for d1x54a1 (1x54 A:1-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790648Species Pyrococcus horikoshii [TaxId:53953] [187575] (4 PDB entries)
  8. 2790649Domain d1x54a1: 1x54 A:1-104 [230394]
    Other proteins in same PDB: d1x54a2
    automated match to d1b8aa1
    protein/RNA complex; complexed with 4ad, mg, mpd

Details for d1x54a1

PDB Entry: 1x54 (more details), 1.45 Å

PDB Description: Crystal structure of asparaginyl-tRNA synthetase from Pyrococcus horikoshii complexed with asparaginyl-adenylate
PDB Compounds: (A:) Asparaginyl-tRNA synthetase

SCOPe Domain Sequences for d1x54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x54a1 b.40.4.0 (A:1-104) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
miekvycqevkpeldgkkvrlagwvytnmrvgkkiflwirdstgivqavvaknvvgeetf
ekakklgressvivegivkaderapggaevhvekleviqavsef

SCOPe Domain Coordinates for d1x54a1:

Click to download the PDB-style file with coordinates for d1x54a1.
(The format of our PDB-style files is described here.)

Timeline for d1x54a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x54a2