SCOPe 2.06: Domain d2cuaa_: 2cua A:

Lineage for d2cuaa_ (2cua A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (35 PDB entries)

8. Domain d2cuaa_: 2cua A: [23039]
   complexed with cua, zn

Details for d2cuaa_

PDB Entry: 2cua, 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

PDB Compounds: (A:) protein (cua)

SCOPe Domain Sequences for d2cuaa_:

Sequence; same for both SEQRES and ATOM records:

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk
itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv
ke

Timeline for d2cuaa_:

• d2cuaa_ first appeared (with stable ids) in SCOP 1.55
  
• d2cuaa_ appears in SCOPe 2.05
  
• d2cuaa_ appears in SCOPe 2.07
  
• d2cuaa_ appears in the current release, SCOPe 2.08