Class b: All beta proteins [48724] (111 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) |
Superfamily b.6.1: Cupredoxins [49503] (5 families) |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries) |
Domain d2cuaa_: 2cua A: [23039] |
PDB Entry: 2cua (more details), 1.6 Å
SCOP Domain Sequences for d2cuaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type} agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv ke
Timeline for d2cuaa_: