Lineage for d2cuaa_ (2cua A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162748Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 162749Protein Cytochrome c oxidase [49544] (4 species)
  7. 162769Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)
  8. 162770Domain d2cuaa_: 2cua A: [23039]

Details for d2cuaa_

PDB Entry: 2cua (more details), 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

SCOP Domain Sequences for d2cuaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk
itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv
ke

SCOP Domain Coordinates for d2cuaa_:

Click to download the PDB-style file with coordinates for d2cuaa_.
(The format of our PDB-style files is described here.)

Timeline for d2cuaa_: