SCOP 1.59: Domain d2cuaa_: 2cua A:

Lineage for d2cuaa_ (2cua A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (3 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)

8. Domain d2cuaa_: 2cua A: [23039]

Details for d2cuaa_

PDB Entry: 2cua, 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

SCOP Domain Sequences for d2cuaa_:

Sequence; same for both SEQRES and ATOM records:

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk
itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv
ke

Timeline for d2cuaa_:

• d2cuaa_ first appeared (with stable ids) in SCOP 1.55
  
• d2cuaa_ appears in SCOP 1.57
  
• d2cuaa_ appears in SCOP 1.61
  
• d2cuaa_ appears in the current release, SCOPe 2.08