Lineage for d2cuaa_ (2cua A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56165Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 56166Protein Cytochrome c oxidase [49544] (3 species)
  7. 56181Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)
  8. 56182Domain d2cuaa_: 2cua A: [23039]

Details for d2cuaa_

PDB Entry: 2cua (more details), 1.6 Å

PDB Description: the cua domain of cytochrome ba3 from thermus thermophilus

SCOP Domain Sequences for d2cuaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
agklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfk
itspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivv
ke

SCOP Domain Coordinates for d2cuaa_:

Click to download the PDB-style file with coordinates for d2cuaa_.
(The format of our PDB-style files is described here.)

Timeline for d2cuaa_: