SCOPe 2.01: Domain d1qleb1: 1qle B:108-252

Lineage for d1qleb1 (1qle B:108-252)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Paracoccus denitrificans [TaxId:266] [49546] (3 PDB entries)

8. Domain d1qleb1: 1qle B:108-252 [23038]
   Other proteins in same PDB: d1qlea_, d1qleb2, d1qlec_, d1qled_, d1qleh_, d1qlel_
   complexed with ca, cu, cua, hea, mn, pc1

Details for d1qleb1

PDB Entry: 1qle, 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1qleb1:

Sequence; same for both SEQRES and ATOM records:

>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

Timeline for d1qleb1:

• d1qleb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qleb1 appears in SCOP 1.75
  
• d1qleb1 appears in SCOPe 2.02
  
• d1qleb1 appears in the current release, SCOPe 2.08