Class b: All beta proteins [48724] (141 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Paracoccus denitrificans [TaxId:266] [49546] (2 PDB entries) |
Domain d1qleb1: 1qle B:108-252 [23038] Other proteins in same PDB: d1qlea_, d1qleb2, d1qlec_, d1qled_, d1qleh_, d1qlel_ |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qleb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans} ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym pivvkavsqekyeawlagakeefaa
Timeline for d1qleb1: