Lineage for d1qleb1 (1qle B:108-252)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292711Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 292712Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 292987Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 292988Protein Cytochrome c oxidase [49544] (4 species)
  7. 293000Species Paracoccus denitrificans [TaxId:266] [49546] (2 PDB entries)
  8. 293002Domain d1qleb1: 1qle B:108-252 [23038]
    Other proteins in same PDB: d1qlea_, d1qleb2, d1qlec_, d1qled_, d1qleh_, d1qlel_

Details for d1qleb1

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

SCOP Domain Coordinates for d1qleb1:

Click to download the PDB-style file with coordinates for d1qleb1.
(The format of our PDB-style files is described here.)

Timeline for d1qleb1: