SCOP 1.61: Domain d1qleb1: 1qle B:108-252

Lineage for d1qleb1 (1qle B:108-252)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
Superfamily b.6.1: Cupredoxins [49503] (5 families)
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
Protein Cytochrome c oxidase [49544] (4 species)
Species Paracoccus denitrificans [TaxId:266] [49546] (2 PDB entries)
Domain d1qleb1: 1qle B:108-252 [23038]
Other proteins in same PDB: d1qlea1, d1qleb2, d1qlec1, d1qled1, d1qleh_, d1qlel_

Details for d1qleb1

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

SCOP Domain Coordinates for d1qleb1:

Click to download the PDB-style file with coordinates for d1qleb1.
(The format of our PDB-style files is described here.)

Timeline for d1qleb1: