SCOP 1.55: Domain d1qleb1: 1qle B:108-252

Lineage for d1qleb1 (1qle B:108-252)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (3 families)

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (3 species)

7. Species Paracoccus denitrificans [TaxId:266] [49546] (2 PDB entries)

8. Domain d1qleb1: 1qle B:108-252 [23038]
   Other proteins in same PDB: d1qlea1, d1qleb2, d1qlec1, d1qled1, d1qleh_, d1qlel_

Details for d1qleb1

PDB Entry: 1qle, 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qleb1:

Sequence; same for both SEQRES and ATOM records:

>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

Timeline for d1qleb1:

• d1qleb1 appears in SCOP 1.57
  
• d1qleb1 appears in the current release, SCOPe 2.08