SCOP 1.65: Domain d1ar1b1: 1ar1 B:108-252

Lineage for d1ar1b1 (1ar1 B:108-252)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Paracoccus denitrificans [TaxId:266] [49546] (2 PDB entries)

8. Domain d1ar1b1: 1ar1 B:108-252 [23037]
   Other proteins in same PDB: d1ar1a_, d1ar1b2, d1ar1c_, d1ar1d_
   complexed with ca, cu, hea, lda, mg

Details for d1ar1b1

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1b1:

Sequence; same for both SEQRES and ATOM records:

>d1ar1b1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

Timeline for d1ar1b1:

• d1ar1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ar1b1 appears in SCOP 1.63
  
• d1ar1b1 appears in SCOP 1.67
  
• d1ar1b1 appears in the current release, SCOPe 2.08