SCOPe 2.06: Domain d1w4re2: 1w4r E:151-191

Lineage for d1w4re2 (1w4r E:151-191)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)

8. Domain d1w4re2: 1w4r E:151-191 [230363]
   Other proteins in same PDB: d1w4ra1, d1w4rb1, d1w4rc1, d1w4rd1, d1w4re1, d1w4rf1, d1w4rg1, d1w4rh1
   automated match to d1xbta2
   complexed with dtu, ttp, zn

Details for d1w4re2

PDB Entry: 1w4r, 1.83 Å

PDB Description: Structure of a type II thymidine kinase with bound dTTP

PDB Compounds: (E:) Thymidine kinase

SCOPe Domain Sequences for d1w4re2:

Sequence; same for both SEQRES and ATOM records:

>d1w4re2 g.39.1.0 (E:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk

Timeline for d1w4re2:

• d1w4re2 first appeared in SCOPe 2.03
  
• d1w4re2 appears in SCOPe 2.05
  
• d1w4re2 appears in SCOPe 2.07
  
• d1w4re2 appears in the current release, SCOPe 2.08