Lineage for d1ocoo1 (1oco O:91-227)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162748Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 162749Protein Cytochrome c oxidase [49544] (4 species)
  7. 162750Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 162760Domain d1ocoo1: 1oco O:91-227 [23036]
    Other proteins in same PDB: d1ocoa1, d1ocob2, d1ococ1, d1ocod1, d1ocoe_, d1ocof_, d1ocog1, d1ocoh_, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo2, d1ocop1, d1ocoq1, d1ocor_, d1ocos_, d1ocot1, d1ocou_, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1

Details for d1ocoo1

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocoo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoo1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1ocoo1:

Click to download the PDB-style file with coordinates for d1ocoo1.
(The format of our PDB-style files is described here.)

Timeline for d1ocoo1: