Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
Protein automated matches [227057] (4 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries) |
Domain d1vtoa1: 1vto A:12-106 [230348] automated match to d1mp9a1 protein/DNA complex |
PDB Entry: 1vto (more details), 1.9 Å
SCOPe Domain Sequences for d1vtoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtoa1 d.129.1.0 (A:12-106) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta lifasgkmvctgaksedfskmaarkyarivqklgf
Timeline for d1vtoa1: