SCOPe 2.03: Domain d1sowb1: 1sow B:15-163

Lineage for d1sowb1 (1sow B:15-163)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [230331] (2 PDB entries)

8. Domain d1sowb1: 1sow B:15-163 [230339]
   Other proteins in same PDB: d1sowa2, d1sowb2
   automated match to d1pzga1
   complexed with nad, oxl

Details for d1sowb1

PDB Entry: 1sow, 1.9 Å

PDB Description: T. gondii bradyzoite-specific LDH (LDH2) in complex with NAD and oxalate

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sowb1:

Sequence; same for both SEQRES and ATOM records:

>d1sowb1 c.2.1.0 (B:15-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm

Timeline for d1sowb1:

• d1sowb1 is new in SCOPe 2.03-stable
  
• d1sowb1 appears in SCOPe 2.04
  
• d1sowb1 appears in the current release, SCOPe 2.08