Lineage for d1sowa2 (1sow A:164-331)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1441394Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1441395Protein automated matches [226850] (21 species)
    not a true protein
  7. 1441537Species Toxoplasma gondii [TaxId:5811] [230334] (2 PDB entries)
  8. 1441540Domain d1sowa2: 1sow A:164-331 [230336]
    Other proteins in same PDB: d1sowa1, d1sowb1
    automated match to d1pzgc2
    complexed with nad, oxl

Details for d1sowa2

PDB Entry: 1sow (more details), 1.9 Å

PDB Description: T. gondii bradyzoite-specific LDH (LDH2) in complex with NAD and oxalate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sowa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sowa2 d.162.1.0 (A:164-331) automated matches {Toxoplasma gondii [TaxId: 5811]}
anvldsarfrrfiadqleisprdiqatvigthgdhmlplaryvtvngfplrefikkgkmt
eaklaeivertkkaggeivrllgqgsayyapalsaitmaqaflkdekrvlpcsvycqgey
glhdmfiglpaviggggieqvieleltheeqecfrksvddvvelnkslaal

SCOPe Domain Coordinates for d1sowa2:

Click to download the PDB-style file with coordinates for d1sowa2.
(The format of our PDB-style files is described here.)

Timeline for d1sowa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sowa1