Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [230331] (2 PDB entries) |
Domain d1sowa1: 1sow A:16-163 [230333] Other proteins in same PDB: d1sowa2, d1sowb2 automated match to d1pzga1 complexed with nad, oxl |
PDB Entry: 1sow (more details), 1.9 Å
SCOPe Domain Sequences for d1sowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sowa1 c.2.1.0 (A:16-163) automated matches {Toxoplasma gondii [TaxId: 5811]} tvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtnv svtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycpl afvivvtnpldcmvkcfheasglpknmvcgm
Timeline for d1sowa1: